Scroll down to see the docs to see what's going on
This is prototype of what a Plate Assay editor might look and work like. This is a prototype, which means many of the proper data and UX guardrails haven't been built-in yet!
This project works by reading data from the Plates sheet on this Google Sheet, and populating the component. Whenever you save, you save the details back to the Google Sheet. Note that I chose to represent the grid as a JSON string, and NOT as individual Google Sheets... but that would also be very possible to do.
All the data is written to and read from: https://docs.google.com/spreadsheets/d/1z_g_BINVA7XzE-qriC-pjcL8pGvj1AOCq-xBB9a8GSw/edit?usp=sharingyeah
This document provides examples of how to interact with the Plate Assay API.
To get all plates, send a GET request to/api/plates.
fetch('https://assay-plate.vercel.app/api/plates', {
method: 'GET',
headers: {
'Content-Type': 'application/json'
}
});
To get a specific plate by ID, send a POST request to /api/plates with the following body:
fetch('https://assay-plate.vercel.app/api/plates', {
method: 'POST',
headers: {
'Content-Type': 'application/json'
},
body: JSON.stringify({
command: 'get',
id: 'phageyphage'
})
});
To delete a specific plate by ID, send a POST request to /api/plates with the following body:
fetch('https://assay-plate.vercel.app/api/plates', {
method: 'POST',
headers: {
'Content-Type': 'application/json'
},
body: JSON.stringify({
command: 'delete',
id: 'phageyphage'
})
});
To create a new plate, send a POST request to /api/plates with the following body. These are NOT checked for inputs:
fetch('https://assay-plate.vercel.app/api/plates', {
method: 'POST',
headers: {
'Content-Type': 'application/json'
},
body: JSON.stringify({
command: 'create',
id: 'phageyphage',
data: {
banana: 'yes'
}
})
});
To initialize or reset plate data, send a POST request to /api/plates with the following body:
fetch('https://assay-plate.vercel.app/api/plates', {
method: 'POST',
headers: {
'Content-Type': 'application/json'
},
body: JSON.stringify({
command: 'set-plate',
id: 'test',
data: {
some: 'rawrrr'
}
})
});
To set plate data, send a POST request to /api/plates with the following body. If an Id doesn't exist, it'll upsert a new plate:
fetch('https://assay-plate.vercel.app/api/plates', {
method: 'POST',
headers: {
'Content-Type': 'application/json'
},
body: JSON.stringify({
"command": "set-plate",
"id": "phageyphage",
"data": {
"meta": {
"name": "somephageytest",
"id": "phageyphage",
"size": "96"
},
"wells": {
"A1": {
"reagent": "R1234",
"antibody": "ACDEFGHIKLMNPQRSTVWYACDEFGHACDEFDFDF",
"concentration": 0.4
},
"B2": {
"reagent": "R1234",
"antibody": "ACDEFGHIKLMNPQRSTVWYACDEFGHACDEFDFDF",
"concentration": 0.4
}
}
}
})
});
To get data for a specific well in a plate, send a POST request to /api/plates with the following body:
fetch('https://assay-plate.vercel.app/api/plates', {
method: 'POST',
headers: {
'Content-Type': 'application/json'
},
body: JSON.stringify({
command: 'get-well',
id: 'test',
wellId: 'B2'
})
});
To add or edit data for a specific well in a plate, send a POST request to /api/plates with the following body:
fetch('https://assay-plate.vercel.app/api/plates', {
method: 'POST',
headers: {
'Content-Type': 'application/json'
},
body: JSON.stringify({
command: 'set-well',
id: 'test',
wellId: 'A1',
data: {
reagent: 'R1111',
antibody: 'YYYAFAFFDGHIKLMNPQRSTVWYACDEFGHACDEFDFDF',
concentration: 0.999
}
})
});